Just a reminder that Tuesday is a Teacher Work Day. There is no school for students. Then we are back at the Creek bright and early on Wednesday morning.
March is going to be a busy month!
- March 14 is our monthly PTA meeting.
- Mr. Hines brings back Jump for Heart towards the end of the month.
- Then the Scholastic Book Fair returns the week of March 20-24. Check the article below for volunteer opportunities.
- On Thursday, March 23, we will have Family Night at the Book Fair and our first ever Family Heart Hop!
As we move towards the end of the year, it is also time to start thinking about our PTA for next year. With your help and our dedicated officers and committee chairs, we've been able to bring back so many favorite activities, such as the Cougar Counter, in person STEM night and Science Fair, and the upcoming Family Heart Hop. We want to continue these opportunities next year, but to do that, we again need your help. If you are interested in being a PTA officer, committee chair, or committee chair next year, please contact our nominating committee (see details below).
Here's to another GREAT week! If you have any questions, please contact any board member.
President, Marie Dexter, [email protected]
Vice President 1, Sarah Wohldmann, [email protected]
Vice President 2, Jessi Andricks, [email protected]
Treasurer, Rebecca Simpson, [email protected]
Secretary, Tina Chadwick, [email protected]
Highlights This Week
- Tuesday, March 7 -- Teacher Work Day. No School for Students.
- Friday, March 10: Deadline for 5th grade dedications for the year book.
The Positivity Project: Spirit Week
Wow! What a Food Drive
On Saturday, the Swift Creek Service Club worked at the food pantry to restock their shelves. The students were so thrilled to give back to our community!
Weekly Wellness
MARCH 6-10 is National School Breakfast Week! Keep an eye out for some fun menu items, outlined below.
Remember, breakfast is the most important meal of the day. It will fuel your body and mind and support concentration.
Add protein like eggs and yogurt with reduced sugar into your breakfast. You can also add the rainbow into your breakfast with lots of fruits!
Tip: Hard Boil eggs the night before for easy breakfast the next day.
For more information on School Meals, Nutritional Quality and Sanitation, click here.
Spring Book Fair: Rock, Roll, and Read!
Kristen is looking for volunteers to help with set up, preview days, sales days, family night at the book fair (which is the same time as the Family Heart Hop), and clean up.
Sign Up now: https://tinyurl.com/scesSpringFair23
NOTE: In order to volunteer you must be a registered to volunteer through WCPSS. If you are not registered, please visit the front office in the school to begin the registration process.
REsults from Chick Fil A Spirit Night
Thank you to our Painless Fundraising chair, Jenae Delayen [email protected], for setting up this event for us.
Our last spirit event of the year will be at Flavors ice cream in April. Look at for more details soon!
Sign Up to be a Watch Dog!
Watch DOGS is a program that encourages Dads, uncles, grandfathers, brothers, cousins to be involved in their child's school. Throughout the day, you will visit and help in the classroom at each grade level. Half day options are also available.
If you have questions or like to sign up for a day to join us at the Creek, please email our Top DOG, Tim Sutton, at [email protected].
Deadline FRIDAY! 5th grade Dedications
It's time to celebrate your 5th grader's end of elementary school! Include a dedication or congratulatory message in the yearbook. We have two price options for you to choose from.
Order online today at swiftcreek.memberhub.com/store.
The deadline for orders is THIS FRIDAY March 10.
Deadline March 18: Vote For your Favorite Yearbook Cover
https://forms.gle/r2hnjMZwyyPx8ixS9
Join Us for the Family Heart Hop on thurs, March 23
Bring your dancing shoes as we get our hearts pumping with lots of moves and grooves in the gym. DJ Burkhalter will be there to lead us in dances, such as the twist! He always brings a lot of energy and excitement to our dance events.
Hungry? We will have several food trucks available in the front parking lot:
Grab some dinner and then eat in the cafeteria with your Swift Creek friends.
Need a break? Shop the Scholastic Book Fair! Remember all profits will go to our school library.
No interest in dancing? Or things too loud in the gym? We will have a room with board games and a quiet room where you can just take a break. And don't forget our scavenger hunt around the school. Return your completed sheet and receive a small prize.
You can see all the details on our PTA website: swiftcreekeswcpssnetptahtml.weebly.com/family-heart-hop.html
Deadline April 4: Order Your Yearbook
If you would like to purchase a yearbook this year, please use the link below:
treering.com/1015281241841003
Can't remember if you already ordered? Log in to TreeRing to find out or contact Yearbook chair, Lauren Nicholls, at [email protected].
We Need YOU in our Pta Next Year!
Here is the timeline for nominations and elections:
- Now - April: Nominating committee will be accepting nominations.
- In the April PTA meeting, the Nominating committee will present the slate of nominees to the general membership. Please note that nominations can continue to be accepted, but we must present the final list of nominees to PTA membership 10 days before the April PTA meeting. Any nominations that come in after that will have to be presented on the floor of the May PTA meeting.
- In the May PTA meeting, we will hold elections for PTA officers for next school year.
- On July 1, the new officers officially begin their term.
If you have any questions or nominations, please contact a member of the Nominating Committee.
- Sarah Wohldmann at [email protected]
- Jessi Andricks at [email protected]
- Deborah Killion at [email protected]
Mark Your Calendars
- Tuesday, March 7: Teacher Work Day
- Tuesday, March 14 6:30pm: PTA meeting
- March 20-24 Spring Book Fair
- Thursday, March 23: Family Night at the Book Fair and Family Heart Hop
- Friday, March 24: Early Release. School dismisses at 1:45pm
- Friday, March 31: Teacher Work Day
- April 3-7: Spring Break
- Tuesday, April 11 6:30pm: PTA Meeting
- Thursday, April 13 Spirit Night at Flavors Ice Cream
- Friday, April 21: Teacher Work Day
- Tuesday, May 9: Early Release. School dismisses at 1:45pm
- Tuesday, May 16 6:30pm: PTA meeting
- Thursday, May 18 5:30-7:30: International Night on the field behind the school
- Tuesday, May 23 5:30-7:30pm Open House at 2600 Timber Drive (temporary space while Swift Creek is being rebuilt)
- Monday, May 29: Memorial Day. No School for students or staff.
- Wednesday, June 7 9:30am: 5th grade awards ceremony on the field behind the school
- Friday, June 9: Last Day of School.
This Week in Pictures
On Thursday (Read Across America Day and Dr. Seuss' birthday), we had dozens of guest readers in our classrooms. They had so much fun sharing some of their favorite books with our eager students! Thank you to everyone who volunteered!
Thank you to our Literacy Coach, Mrs. McKoy, and Media Specialist, Mrs. Green, for making this week so special. Also thank you to our staff for encouraging the love of reading in our students!